Patellin-3
Webpatellin-3. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. LOC105110573 patellin-3 [ (Euphrates poplar)] Gene ID: 105110573, updated on 3-Jun-2024. Summary. Other designations. patellin-3 ... WebArabidopsis EXO70A1 recruits Patellin3 to the cell membrane independent of its role as an exocyst subunit The exocyst is a well-known complex which tethers vesicles at the cell …
Patellin-3
Did you know?
Webpatellin 2; purple, patellin 3. (B) Dorsal root ganglion assay using cultivated mouse neurons. Each trace represents the response of a single neuron in culture. KCl (arrows on the x axis) is added to the culture and removed, leading to depolarization and Ca2+ entry into the cell, measured using the fluorescence ratio of Ca2+-responsive Fura-2 ... WebJan 29, 2024 · PATLs are plasma membrane-associated proteins accumulated in Arabidopsis embryos, primary roots, lateral root primordia and developing stomata. Higher order patl mutants display reduced …
WebApr 19, 2024 · In this study, we report that Patellin1 (PATL1), a membrane trafficking-related protein, modulates salt tolerance in Arabidopsis. The T-DNA insertion mutant of PATL1 ( patl1) with an elevated PATL1 transcription level displays a salt-sensitive phenotype. Webtwo members of theArabidopsis Patellin (PATL) family:Patellins 3 and 6 (atPATL3 and atPATL6). PATLs are related to Sec14 (Peterman et al., 2004),which is the defining …
WebOct 25, 2005 · Function Carrier protein that may be involved in membrane-trafficking events associated with cell plate formation during cytokinesis. Binds to some hydrophobic molecules such as phosphoinositides and promotes their transfer between the different cellular sites ( By similarity ). By similarity Miscellaneous 'Patella' means 'small plate' in … WebMay 12, 2016 · The patellin proteins are Sec14-like proteins characterized by a variable N-terminal domain, a lipid-binding domain and a C-terminal GOLD domain (Peterman et al. …
Webgenome browser: aa seq: 557 aa aa seq db search maeevpktsttqeevvvsdvapaekpdttnvvvvplekdaqpqqneeetspekkkenvte tetesevskpsgdgnvpesgsfkeestivsdlpetekkalqelkqliqealnkhefsavp
WebOct 25, 2005 · Function. Carrier protein that may be involved in membrane-trafficking events associated with cell plate formation during cytokinesis. Binds to some hydrophobic … donima下载WebVesicle transport is a central process to ensure protein and lipid distribution in eukaryotic cells. The current knowledge on the molecular components and mechanisms of this process is majorly based on studies in Saccharomyces cerevisiae and Arabidopsis thaliana, which revealed 240 different proteinaceous factors either experimentally proven or predicted to … do nike run smallWebJul 15, 2024 · Similarly, a SEC14-like protein, Patellin 3 (PATL3), accumulates in the intracellular structures when expressed in exo70a1 mutant . This indicates high importance of EXO70A1 in PM targeting of different proteins within a cell. In contrast to the clear secretory function of EXO70A1, the function of EXO70B1 is far more enigmatic. donimirskaWebSep 10, 2015 · This pathway starts with a condensation of malonyl-CoA and 4-coumaroyl CoA, and is catalysed by multiple enzymes including chalcone synthase (CHS), chalcone isomerase (CHI), flavanone 3-hydroxylase (F3H), flavonoid 3′-hydroxylase (F3′H), flavonoid 3′5′-hydroxylase (F3′5′H), dihydroflavonol 4-reductase (DFR), and UDPG-flavonoid … do nikon cameras take videoWebApr 1, 2014 · Patellins 3 and 6, two members of the Plant Patellin family, interact with the movement protein of Alfalfa mosaic virus and interfere with viral movement Authors: Ana … donikorWebSep 27, 2024 · The higher accumulation of the Patellin-3-like (Ce_fissilis.016593.1) and CDC48 (Ce_fissilis.012572.1) proteins in shoot cuttings at 3 days rooting, which also occurred with higher endogenous IAA contents (Fig. 5), can be related to cell divisions during the formation of meristematic centers (Figs. 3b and 7), promoting the formation of … r2 L\u0027vovWebDec 19, 2013 · Abstract Peanut ( Arachis hypogaea L) is one of the widely cultivated and leading oilseed crops of the world and its yields are greatly affected by various biotic and abiotic stresses. Arachis diogoi, a wild relative of peanut, is an important source of genes for resistance against various stresses that affect peanut. r2 melodrama\u0027s