2024 Tlc domain-containing protein

Tlc domain-containing protein

Author: xfny

August undefined, 2024

WebAug 6, 2024 · In plants, TLC is cataloged as a ‘lipid-sensing domain containing protein’ and its molecular function is unknown (Araport11). However, TLC was identified in a GWAs as … WebTLC is a protein domain with at least 5 transmembrane alpha-helices. Lag1p and Lac1p are essential for acyl-CoA-dependent ceramide synthesis [ ( PUBMED:11694577 ) ], TRAM is a …

Frontiers Genome-Wide Association Study Reveals Key Genes for ...

WebJan 1, 2012 · Phylogenetic analysis reveals that the Hox-like domain-containing family members divide into two distinct branches, CerS2, -3, and -4 and CerS5 and -6 ( Fig. 1A ), with the former using mainly very long chain acyl-CoAs (C18–26) and the latter using long chain (C14–16) CoAs. WebTLC DOMAIN-CONTAINING PROTEIN 3B; TLCD3B Alternative titles; symbols FAMILY WITH SEQUENCE SIMILARITY 57, MEMBER B; FAM57B HGNC Approved Gene Symbol: TLCD3B … mems vision international inc

Tlcd1 MGI Mouse Gene Detail - MGI:1915572 - TLC domain containing 1

WebOct 5, 2010 · Status. UniProtKB reviewed (Swiss-Prot) Organism. Homo sapiens (Human) Amino acids. 245. Protein existence. Evidence at transcript level. Annotation score. WebThe TLC (TRAM-LAG1-CLN8) domain is an about 200-residue domain found in a family of membrane-associated proteins related to yeast LAG1 and mammalian TRAM. It is predicted to contain five transmembrane α helices [ 1 ]. Although the role of the TLC domain is not known, four possible function have been suggested: WebMar 1, 2003 · TLC domain-containing protein 4 Gene Tlcd4 Status UniProtKB reviewed (Swiss-Prot) Organism Mus musculus (Mouse) Amino acids 276 Protein existence … mems vibration motor

A New Functional Motif in Hox Domain-containing Ceramide Synthases

UniProt

WebThe TLDc domain-containing proteins could influence the expression of key oxygen free-radical scavengers that, in turn, reduce the levels of ROS in the cell [ (PUBMED:28707022) … WebZSWIM3蛋白抗体产品介绍：英文名称 Anti-ZSWIM3 中文名称 ZSWIM3蛋白抗体别名 Zinc finger SWIM domain containing protein 3; C20orf164; Zinc finger SWIM type containin mems vs electret microphoneWebSep 1, 2002 · Structurally, the FLD-1 and TLCD1/2 proteins are characterized by the presence of a TLC domain and are therefore distantly related to the ER-localized ceramide synthases (human CERS1-6) and... mem switchgear catalogue

"WebM02B1.3 TLC domain-containing protein [] Gene ID: 178236, updated on 22-Sep-2024 Summary Predicted to be involved in several processes, including membrane assembly; phospholipid homeostasis; and regulation of membrane lipid … " - Tlc domain-containing protein

Tlc domain-containing protein

WebThe mammalian CerS proteins contain a number of distinguishing features. Prominent among these are two domains, (i) the T ram- L ag- C LN8 (TLC) domain, defined in a broad manner as a region of ∼200 residues also found in other proteins ( 7 ) and in a narrower manner as the Lag domain, a region of ∼50 amino acid residues ( 8 WebProtein Domains Domain, Family, and Site Summary 1 - 2 of 2 Domain Details Per Protein 1 - 1 of 1 Transcripts Genome Browsers NCBI No data available Interactions and Pathways No data available Antibodies No data available Plasmids No data available Constructs No data available Marker Relationships 1 - 2 of 2 Show Sequences Overview ( 3)

Did you know?

WebAug 7, 1998 · Thin-layer chromatography (TLC) is one of the simplest and most convenient techniques to separate small molecules. Of a variety of TLC separation modes, only size … WebDec 1, 2001 · TLC domain-containing protein 1 BLAST Add Sequence: RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE

WebSep 9, 2013 · LC is performed in two different settings: on planes as thin-layer chromatography TLC and as paper chromatography PC (simple and cheap but out of … WebTLCD5TLC domain containing 5 [ Homo sapiens(human) ] Gene ID: 219902, updated on 22-Sep-2024 Download Datasets Gene Sequences (FASTA) Transcript sequences (FASTA) …

WebMar 9, 2015 · Sterile alpha motif and histidine-aspartate domain-containing protein 1 (SAMHD1) is a recently discovered enzyme that plays a central role in nucleotide metabolism and innate immunity. ... dGTP. Small portions (2 µL) were quenched at various times by direct spotting on a C18 reversed-phase TLC plate. The TLC plates were … WebSep 14, 2007 · First, TLC domain-containing proteins were identified using the Prosite domain data base ( 15 ). The entries were analyzed to determine which have a Hox domain. 32 proteins were selected for further analysis from a wide range of organisms. The Hox domains in most of these proteins were incomplete, with the N-terminal portion of the …

WebTRAM1 and TLC domain-containing protein. ... Description: Interval: E-value: TLC: smart00724: TRAM, LAG1 and CLN8 homology domains; Protein domain with at least 5 transmembrane ... 112-321: 6.19e-34: TRAM, LAG1 and CLN8 homology domains; Protein domain with at least 5 transmembrane alpha-helices. Lag1p and Lac1p are essential for …

WebSummary Gene: Tlcd4 (TLC domain containing 4) Mus musculus Add Watcher Analyze General Array IDs Annotation Click to see Annotation Detail View Gene-Chemical Interaction Annotations Click to see Annotation Detail View Gene Ontology Annotations Click to see Annotation Detail View Biological Process lipid homeostasis (IBA) Cellular Component mem switchboardWebDec 29, 2024 · Selenoprotein K (SELENOK) is a selenocysteine (Sec)-containing protein localized in the endoplasmic reticulum (ER) membrane where it interacts with the DHHC6 (where single letter symbols represent Asp-His-His-Cys amino acids) enzyme to promote protein acyl transferase (PAT) reactions. mems wlcspWebTLCD1 → TLC domain-containing protein 1. Protein also known as : Calfacilitin . Gene name : TLCD1. Entry whose protein (s) existence is based on evidence at protein level. Show … mems world summit euWebbuilding phylogenetic trees of all of TLC domain-containing proteins, on which they formed a distinct branch. Due to the large number of non-Hox sequences, representative species were chosen to build the alignment and logos. SMART motif analysis (18) was performed on mouse Cers5. Analysis of the sequence of the last 12 residues of the Hox ... memsys是ccfWebMar 21, 2024 · TLCD2 (TLC Domain Containing 2) is a Protein Coding gene. Diseases associated with TLCD2 include Chromosome 17P13.3, Centromeric, Duplication … mems world summit mws -chinaWebTLC domain containing 1 Synonyms 0610007A15Rik, 0610030G03Rik Feature Type protein coding gene IDs MGI:1915572 NCBI Gene: 68385 Alliance gene page Transcription Start Sites 5 TSS Location &Maps more Sequence Map Chr11:78068956-78071646 bp, + strand From NCBI annotation of GRCm39 mems weightliftingWebTLC domain Links Statistics Structure Aligned Rows: Download Cn3D PubMed References Sequence Alignment include consensus sequence Format:HypertextPlain … mems wafer level packaging